PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G10620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 249aa    MW: 27438.4 Da    PI: 8.7052
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G10620.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.88.7e-161050242
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                     ri n+ +r  tf kR++g+ KKA EL +LC+++ ++i++++
  LPERR02G10620.1 10 RILNDAQRRATFKKRLKGLTKKATELATLCGVDMCLIVYAK 50
                     899***********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.549149IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-13161IPR002100Transcription factor, MADS-box
CDDcd002662.57E-22286No hitNo description
PRINTSPR004046.4E-8323IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.42E-21395IPR002100Transcription factor, MADS-box
PfamPF003193.8E-161049IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MARKRVKLQR ILNDAQRRAT FKKRLKGLTK KATELATLCG VDMCLIVYAK GAVEATEVWP  60
SVPEATSILE RFKAMPDLDR YKRATNLEGF LKDEIDKLQK ELHKVKSEAD ESETKLLLFE  120
ALDGRHPSFE GLSIEQLTNL AWMVDARQKI VNNRLEELRR HGLLPAPTPL LAMGKLPHDI  180
VDNTNVEKPP NQQEGSLMDV GRSIDSLGHD GFGATSGSST AGPNGDMLQV FSSGAGSSSA  240
NQGFLFPPK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225RKRVKLQRILNDAQRRATFKKRLK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629573.11e-103PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0D9VEX80.0A0A0D9VEX8_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g38610.11e-102(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.18e-29AGAMOUS-like 80